PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0608s0150.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family GRF
Protein Properties Length: 449aa    MW: 48657.4 Da    PI: 9.3347
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0608s0150.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC74.88.9e-2481125145
                     WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                             d+epgrCrRtDGKkWRCsr++++++k+CErH++rgr+rsrk++e 
  SapurV1A.0608s0150.2.p  81 DQEPGRCRRTDGKKWRCSRDAVADQKYCERHINRGRHRSRKPVEG 125
                             689***************************************985 PP

2QLQ58.32.3e-201046137
                     QLQ  1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                            ++FT++Q+++L++Q+l+yKy+ a++PvP++L+ +++k
  SapurV1A.0608s0150.2.p 10 GPFTPSQWMELEHQALIYKYITARVPVPSNLIIPLKK 46
                            59******************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009513.3E-121046IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.491146IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.5E-141144IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.79681125IPR014977WRC domain
PfamPF088792.4E-2083124IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 449 aa     Download sequence    Send to blast
MHGAFTGVRG PFTPSQWMEL EHQALIYKYI TARVPVPSNL IIPLKKSLNL YGLPGSSAGS  60
FPPSSLGWGT FHLGYPGNNT DQEPGRCRRT DGKKWRCSRD AVADQKYCER HINRGRHRSR  120
KPVEGQTGHA ATGTASSKVV SMSNSISTSV TTSGAASNSI VITQQQLKKL LPGAASRSSA  180
VARVNGAQDA QRVSMMSSTI NRRSDEPTFC IPKQDILIEQ CSQTEFGLVS YDSLLNPSQK  240
SSYISSKPYE SFLNFSDEES HDQHPLRQFI DDWPKDQSNR SVISWPEELK PDCTLLSMSI  300
PMASSGFSSP SSSPMREKLA LSPLRLSREI HPMQTGLRVS DEHNESSQKQ ANWIPISWGT  360
SIGGPLGEVL TTSTSHVDSC KSSPALNLSR EGWDGSLQVG SSPTGVLQKS TFRSLSNSSS  420
GSSPRAGSKK KNESAGLYED MAGSIIVS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU2826941e-155GU282694.1 Populus balsamifera isolate HAY07 haplotype A unknown protein gene, partial sequence.
GenBankGU2826951e-155GU282695.1 Populus balsamifera isolate HAY07 haplotype B unknown protein gene, partial sequence.
GenBankGU2826961e-155GU282696.1 Populus balsamifera isolate MGR10 haplotype A unknown protein gene, partial sequence.
GenBankGU2826971e-155GU282697.1 Populus balsamifera isolate MGR10 haplotype B unknown protein gene, partial sequence.
GenBankGU2826981e-155GU282698.1 Populus balsamifera isolate NWL07 haplotype A unknown protein gene, partial sequence.
GenBankGU2826991e-155GU282699.1 Populus balsamifera isolate NWL07 haplotype B unknown protein gene, partial sequence.
GenBankGU2827001e-155GU282700.1 Populus balsamifera isolate STL13 haplotype A unknown protein gene, partial sequence.
GenBankGU2827011e-155GU282701.1 Populus balsamifera isolate STL13 haplotype B unknown protein gene, partial sequence.
GenBankGU2827021e-155GU282702.1 Populus balsamifera isolate INU03 haplotype A unknown protein gene, partial sequence.
GenBankGU2827031e-155GU282703.1 Populus balsamifera isolate INU03 haplotype B unknown protein gene, partial sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002310328.20.0hypothetical protein POPTR_0007s14720g
SwissprotO810011e-103GRF1_ARATH; Growth-regulating factor 1
TrEMBLB9HFY60.0B9HFY6_POPTR; Uncharacterized protein
STRINGPOPTR_0007s14720.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22840.17e-83growth-regulating factor 1